Factor VII (F7) Rabbit Polyclonal Antibody

CAT#: TA342831

Rabbit Polyclonal Anti-F7 Antibody

Product Images

WB Suggested Anti-F7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-F7 antibody: synthetic peptide directed towards the middle region of human F7. Synthetic peptide located within the following region: RCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQGRIVGGKVCPKG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: coagulation factor VII
• Database Link:
  NP_000122
  Entrez Gene 2155 Human
  UniProt ID P08709
• Background: This gene encodes coagulation factor VII which is a vitamin K-dependent factor essential for hemostasis. This factor circulates in the blood in a zymogen form, and is converted to an active form by either factor IXa, factor Xa, factor XIIa, or thrombin by minor proteolysis. Upon activation of the factor VII, a heavy chain containing a catalytic domain and a light chain containing 2 EGF-like domains are generated, and two chains are held together by a disulfide bond. In the presence of factor III and calcium ions, the activated factor then further activates the coagulation cascade by converting factor IX to factor IXa and/or factor X to factor Xa. Alternative splicing of this gene results in 2 transcripts. Defects in this gene can cause coagulopathy.
• Synonyms: SPCA
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Rabbit: 85%; Rat: 83%; Pig: 79%

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Complement and coagulation cascades