PNR (TAAR5) Rabbit Polyclonal Antibody

CAT#: TA342677

Rabbit Polyclonal Anti-TAAR5 Antibody

Product Images

WB Suggested Anti-TAAR5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: PANC1 cell lysate TAAR5 is supported by BioGPS gene expression data to be expressed in PANC1

• 

  Immunofluorescence -- Dilution: 1.3ug/mL

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAAR5 antibody: synthetic peptide directed towards the C terminal of human TAAR5. Synthetic peptide located within the following region: TTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: trace amine associated receptor 5
• Database Link:
  NP_003958
  Entrez Gene 215854 MouseEntrez Gene 9038 Human
  UniProt ID O14804
• Background: TAAR5 is an orphan receptor. Ligands are likely small molecules, either sharing some similarities with trace amine as, e.g. derivatives of indolamines (such as 5-methoxytryptamine) or of phenylethylamines (such as phenylethanolamine) or being any kind of metabolite of amino acids or biogenic amine neurotransmitters.
• Synonyms: PNR
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 91%; Rabbit: 91%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction