Myoferlin (MYOF) Rabbit Polyclonal Antibody

CAT#: TA341923

Rabbit Polyclonal Anti-FER1L3 Antibody

Product Images

WB Suggested Anti-FER1L3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: MCF7 cell lysate.MYOF is strongly supported by BioGPS gene expression data to be expressed in MCF7

• 

  2Hum. Adult Placenta; Host: Rabbit; Target Name: CHAD; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: MYOF; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: MYOF; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: MYOF; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: MYOF; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: MYOF; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml.MYOF is strongly supported by BioGPS gene expression data to be expressed in HeLa

• Host: Rabbit; Target Name: MYOF; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml; MYOF is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Show all 8 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FER1L3 antibody: synthetic peptide directed towards the C terminal of human FER1L3. Synthetic peptide located within the following region: QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 235 kDa
• Gene Name: myoferlin
• Database Link:
  NP_038479
  Entrez Gene 26509 Human
  UniProt ID Q9NZM1
• Background: Mutations in dysferlin, a protein associated withThe plasma membrane, can cause muscle weakness that affects both proximal and distal muscles.The protein encoded byThis gene is a type II membrane protein that is structurally similar to dysferlin. It is a member ofThe ferlin family and associates with both plasma and nuclear membranes.The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found forThis gene. Other possible variants have been detected, butTheir full-length nature has not been determined. [provided by RefSeq, Dec 2008]
• Synonyms: FER1L3
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane