Myoferlin (MYOF) Rabbit Polyclonal Antibody
Frequently bought together (2)
Other products for "Myoferlin"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FER1L3 antibody: synthetic peptide directed towards the C terminal of human FER1L3. Synthetic peptide located within the following region: QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 235 kDa |
Gene Name | myoferlin |
Database Link | |
Background | Mutations in dysferlin, a protein associated withThe plasma membrane, can cause muscle weakness that affects both proximal and distal muscles.The protein encoded byThis gene is a type II membrane protein that is structurally similar to dysferlin. It is a member ofThe ferlin family and associates with both plasma and nuclear membranes.The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found forThis gene. Other possible variants have been detected, butTheir full-length nature has not been determined. [provided by RefSeq, Dec 2008] |
Synonyms | FER1L3 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86%; Zebrafish: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.