TOB (TOB1) Rabbit Polyclonal Antibody

CAT#: TA341823

Rabbit Polyclonal Anti-TOB1 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of transducer of ERBB2, 1 (TOB1)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TOB1 antibody: synthetic peptide directed towards the middle region of mouse TOB1. Synthetic peptide located within the following region: QPLTFTTATFAATKFGSTKMKNSGRSSKVARTSPINLGLTVNVNDLLKQK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40 kDa
Gene Name transducer of ERBB2, 1
Background Anti-proliferative protein;The function is mediated by association with deadenylase subunits ofThe CCR4-NOT complex.
Synonyms APRO5; APRO6; PIG49; TOB; TROB; TROB1
Note Immunogen Sequence Homology: Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Human: 93%; Bovine: 93%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.