MEPE Rabbit Polyclonal Antibody

CAT#: TA341733

Rabbit Polyclonal Anti-MEPE Antibody

Product Images

WB Suggested Anti-MEPE Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MEPE antibody: synthetic peptide directed towards the middle region of human MEPE. Synthetic peptide located within the following region: LPGREGNRVDAGSQNAHQGKVEFHYPPAPSKEKRKEGSSDAAESTNYNEI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: matrix extracellular phosphoglycoprotein
• Database Link:
  NP_064588
  Entrez Gene 56955 Human
  UniProt ID Q9NQ76
• Background: This gene encodes a secreted calcium-binding phosphoprotein that belongs toThe small integrin-binding ligand, N-linked glycoprotein (SIBLING) family of proteins. Members ofThis family are components ofThe extracellular matrix of bone and dentin and regulate bone mineralization. Deficiency of a similar protein in mouse results in increased bone mass. Mice lackingThis gene are resistant to aging-related trabecular bone loss. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
• Synonyms: OF45
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Secreted Protein