GJB6 Rabbit Polyclonal Antibody

CAT#: TA341667

Rabbit Polyclonal Anti-GJB6 Antibody

Product Images

WB Suggested Anti-GJB6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GJB6 antibody: synthetic peptide directed towards the middle region of human GJB6. Synthetic peptide located within the following region: CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: gap junction protein beta 6
• Database Link:
  NP_006774
  Entrez Gene 10804 Human
  UniProt ID O95452
• Background: Gap junctions allowThe transport of ions and metabolites betweenThe cytoplasm of adjacent cells.They are formed by two hemichannels, made up of six connexin proteins assembled in groups. Each connexin protein has four transmembrane segments, two extracellular loops, a cytoplasmic loop formed betweenThe two inner transmembrane segments, andThe N- and C-terminus both being inThe cytoplasm.The specificity ofThe gap junction is determined by which connexin proteins compriseThe hemichannel. InThe past, connexin protein names were based onTheir molecular weight, howeverThe new nomenclature uses sequential numbers based on which form (alpha or beta) ofThe gap junction is present.This gene encodes one ofThe connexin proteins. Mutations inThis gene have been found in some forms of deafness and in some families with hidrotic ectodermal dysplasia. [provided by RefSeq, Jul 2008]
• Synonyms: CX30; DFNA3; DFNA3B; DFNB1B; ECTD2; ED2; EDH; HED; HED2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Pig: 92%; Mouse: 92%; Guinea pig: 92%; Bovine: 86%; Rabbit: 85%; Goat: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane