ZNF300 Rabbit Polyclonal Antibody

CAT#: TA341437

Rabbit Polyclonal Anti-ZNF300 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "ZNF300"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF300 antibody: synthetic peptide directed towards the N terminal of human ZNF300. Synthetic peptide located within the following region: DISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGSL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 69 kDa
Gene Name zinc finger protein 300
Background The protein encoded byThis gene is a C2H2-type zinc finger DNA binding protein and likely transcriptional regulator.The function ofThis protein is not yet known. Three transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2010]
Synonyms DKFZp686B24204
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Bovine: 92%; Horse: 79%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.