RWDD2A Rabbit Polyclonal Antibody

CAT#: TA340213

Rabbit Polyclonal Anti-RWDD2A Antibody

Product Images

WB Suggested Anti-RWDD2A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RWDD2A antibody: synthetic peptide directed towards the N terminal of human RWDD2A. Synthetic peptide located within the following region: NALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: RWD domain containing 2A
• Database Link:
  NP_219479
  Entrez Gene 112611 Human
  UniProt ID Q9UIY3
• Background: The specific function of RWDD2A is not yet known.
• Synonyms: dJ747H23.2; RWDD2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Bovine: 86%