PHC1 Rabbit Polyclonal Antibody

CAT#: TA339865

Rabbit Polyclonal Anti-PHC1 Antibody

Product Images

Host: Rabbit; Target Name: PHC1; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DKFZp686A1782 antibody is: synthetic peptide directed towards the C-terminal region of Human DKFZp686A1782. Synthetic peptide located within the following region: PLSVRAGHGERDLGNPNTAPPTPELHGINPVFLSSNPSRWSVEEVYEFIA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: polyhomeotic homolog 1
• Database Link:
  NP_004417
  Entrez Gene 1911 Human
  UniProt ID P78364
• Background: This gene is a homolog of the Drosophila polyhomeotic gene, which is a member of the Polycomb group of genes. The gene product is a component of a multimeric protein complex that contains EDR2 and the vertebrate Polycomb protein BMH1. The gene product, the EDR2 protein, and the Drosophila polyhomeotic protein share 2 highly conserved domains, named homology domains I and II. These domains are involved in protein-protein interactions and may mediate heterodimerization of the protein encoded by this gene and the EDR2 protein.
• Synonyms: EDR1; HPH1; MCPH11; RAE28
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Rat: 86%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Stem cell - Pluripotency