ZFYVE19 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of zinc finger, FYVE domain containing 19 (ZFYVE19)
USD 665.00
Recombinant protein of human zinc finger, FYVE domain containing 19 (ZFYVE19), 20 µg
USD 867.00
Other products for "ZFYVE19"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZFYVE19 antibody: synthetic peptide directed towards the C terminal of human ZFYVE19. Synthetic peptide located within the following region: CNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 51 kDa |
Gene Name | zinc finger FYVE-type containing 19 |
Database Link | |
Background | ZFYVE19 contains 1 FYVE-type zinc finger. A chromosomal aberration, translocation t(11;15)(q23;q14) with MLL/HRX, involving ZFYVE19 is associated with acute myeloblastic leukemia (AML). |
Synonyms | ANCHR; MPFYVE |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.