Ephrin B1 (EFNB1) Rabbit Polyclonal Antibody

CAT#: TA339414

Rabbit Polyclonal Anti-EFNB1 Antibody

Product Images

WB Suggested Anti-EFNB1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EFNB1 antibody: synthetic peptide directed towards the middle region of human EFNB1. Synthetic peptide located within the following region: SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: ephrin B1
• Database Link:
  NP_004420
  Entrez Gene 13641 MouseEntrez Gene 1947 Human
  UniProt ID P98172
• Background: The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. [provided by RefSeq, Jul 2008]
• Synonyms: CFND; CFNS; EFB1; EFL3; Elk-L; EPLG2; LERK2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Axon guidance