GPSM2 Rabbit Polyclonal Antibody

CAT#: TA339182

Rabbit Polyclonal Anti-GPSM2

Product Images

GPSM2 antibody - N-terminal region validated by WB using Fetal Liver Lysate at 1 ug/ml.

• 

  IAnti-GPSM2 antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

• 

  Rabbit Anti-GPSM2 Antibody; Paraffin Embedded Tissue: Human Liver; Antibody Concentration: 5 ug/ml

• 

  Anti-GPSM2 antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

• 

  GPSM2 antibody - N-terminal region in human cell lines with GFP-LGN fusion using Immunofluorescence.

Show all 5 images

Specifications

Product Data

• Applications: IF, IHC, WB
• Recommended Dilution: IHC, WB, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPSM2 antibody: synthetic peptide directed towards the N terminal of human GPSM2. Synthetic peptide located within the following region: YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: G-protein signaling modulator 2
• Database Link:
  NP_037428
  Entrez Gene 29899 Human
  UniProt ID P81274
• Background: Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins.Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins (Blumer et al., 2002 [PubMed 11832491]). [supplied by OMIM]
• Synonyms: CMCS; DFNB82; LGN; PINS
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome