SLC66A2 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of PQ loop repeat containing 1 (PQLC1), transcript variant 1
USD 436.00
Recombinant protein of human PQ loop repeat containing 1 (PQLC1), 20 µg
USD 867.00
Other products for "SLC66A2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PQLC1 antibody: synthetic peptide directed towards the middle region of human PQLC1. Synthetic peptide located within the following region: TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 30 kDa |
Gene Name | PQ loop repeat containing 1 |
Database Link | |
Background | PQLC1 is a multi-pass membrane protein. It contains 2 PQ-loop domains. The exact function of PQLC1 remains unknown. |
Synonyms | FLJ22378 |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Rat: 86%; Guinea pig: 86%; Mouse: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.