KCNH3 Rabbit Polyclonal Antibody

CAT#: TA338568

Rabbit Polyclonal Anti-KCNH3 Antibody

Product Images

WB Suggested Anti-KCNH3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNH3 antibody: synthetic peptide directed towards the middle region of human KCNH3. Synthetic peptide located within the following region: SGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 117 kDa
• Gene Name: potassium voltage-gated channel subfamily H member 3
• Database Link:
  NP_036416
  Entrez Gene 23416 Human
  UniProt ID Q9ULD8
• Background: Pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits an outward current with fast inactivation. Channel properties may be modulated by cAMP and subunit assembly.
• Synonyms: BEC1; ELK2; Kv12.2
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Guinea pig: 93%; Rat: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane