PIG3 (TP53I3) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1, 20 µg
USD 867.00
Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2
USD 436.00
Other products for "PIG3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TP53I3 antibody is: synthetic peptide directed towards the C-terminal region of Human TP53I3. Synthetic peptide located within the following region: SKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 26 kDa |
Gene Name | tumor protein p53 inducible protein 3 |
Database Link | |
Background | The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell death. It contains a p53 consensus binding site in its promoter region and a downstream pentanucleotide microsatellite sequence. P53 has been shown to transcriptionally activate this gene by interacting with the downstream pentanucleotide microsatellite sequence. The microsatellite is polymorphic, with a varying number of pentanucleotide repeats directly correlated with the extent of transcriptional activation by p53. It has been suggested that the microsatellite polymorphism may be associated with differential susceptibility to cancer. |
Synonyms | PIG3 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 86%; Bovine: 86%; Rabbit: 86%; Dog: 85%; Horse: 83% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | p53 signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.