DHRS9 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2
USD 436.00
Recombinant protein of human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, 20 µg
USD 867.00
Other products for "DHRS9"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DHRS9 antibody: synthetic peptide directed towards the middle region of human DHRS9. Synthetic peptide located within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 35 kDa |
Gene Name | dehydrogenase/reductase 9 |
Database Link | |
Background | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
Synonyms | 3-alpha-HSD; 3ALPHA-HSD; RDH-E2; RDH-TBE; RDH15; RDHL; RDHTBE; RETSDR8; SDR9C4 |
Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 92% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Retinol metabolism |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.