OR5B17 Rabbit Polyclonal Antibody

CAT#: TA337519

Rabbit Polyclonal Anti-OR5B17 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "OR5B17"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-OR5B17 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5B17. Synthetic peptide located within the following region: FNVFFALLVTLISYLFILITILKRHTGKGYQKPLSTCGSHLIAIFLFYIT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 34 kDa
Gene Name olfactory receptor family 5 subfamily B member 17
Background OR5B17 is a potential odorant receptor.
Synonyms OR5B20P; OR11-237
Note Immunogen Sequence Homology: Human: 100%; Rat: 79%
Reference Data
Protein Families Transmembrane
Protein Pathways Olfactory transduction

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.