LPP Rabbit Polyclonal Antibody

CAT#: TA335709

Rabbit Polyclonal Anti-LPP Antibody

Product Images

WB Suggested Anti-LPP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: COLO205 cell lysateLPP is supported by BioGPS gene expression data to be expressed in COLO205

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LPP Antibody: synthetic peptide directed towards the N terminal of human LPP. Synthetic peptide located within the following region: GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: LIM domain containing preferred translocation partner in lipoma
• Database Link:
  NP_005569
  Entrez Gene 4026 Human
  UniProt ID Q93052
• Background: LPP may play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. LPP may be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. LPP is also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus.
• Synonyms: DKFZp779O0231; FLJ30652; FLJ41512
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 92%; Horse: 92%; Rabbit: 92%; Bovine: 81%