PAOX Rabbit Polyclonal Antibody

CAT#: TA335328

Rabbit Polyclonal Anti-PAOX Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 5, 20 µg
    • 20 ug

USD 867.00


Transient overexpression lysate of polyamine oxidase (exo-N4-amino) (PAOX), transcript variant 1
    • 100 ug

USD 436.00

Other products for "PAOX"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PAOX Antibody: synthetic peptide directed towards the middle region of human PAOX. Synthetic peptide located within the following region: RGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 53 kDa
Gene Name polyamine oxidase (exo-N4-amino)
Background PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs.
Synonyms PAO
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.