METRNL Rabbit Polyclonal Antibody

CAT#: TA334847

Rabbit Polyclonal Anti-METRNL Antibody


USD 539.00

2 Weeks*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "METRNL"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-METRNL antibody is: synthetic peptide directed towards the C-terminal region of Human METRNL. Synthetic peptide located within the following region: GVRPGHGDFLFTGHMHFGEARLGCAPRFKDFQRMYRDAQERGLNPCEVGT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name meteorin, glial cell differentiation regulator-like
Background The function of this protein remains unknown.
Synonyms MGC99788
Note Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Pig: 92%; Rat: 92%; Horse: 92%; Guinea pig: 92%; Yeast: 90%; Dog: 86%; Rabbit: 86%; Mouse: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.