PTGER3 Rabbit Polyclonal Antibody

CAT#: TA334751

Rabbit Polyclonal Anti-PTGER3 Antibody

Product Images

WB Suggested Anti-PTGER3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the middle region of human PTGER3. Synthetic peptide located within the following region: ILDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: prostaglandin E receptor 3
• Database Link:
  NP_000948
  Entrez Gene 5733 Human
  UniProt ID P43115
• Background: PTGER3 is the receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems.The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Multiple alternatively spliced transcript variants encoding eight distinct isoforms have been reported.
• Synonyms: EP3; EP3-I; EP3-II; EP3-III; EP3-IV; EP3e; MGC27302; MGC141828; MGC141829
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transcription Factors, Transmembrane
• Protein Pathways: Calcium signaling pathway, Neuroactive ligand-receptor interaction