PARP12 Rabbit Polyclonal Antibody

CAT#: TA334714

Rabbit Polyclonal Anti-PARP12 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "PARP12"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PARP12 antibody: synthetic peptide directed towards the middle region of human PARP12. Synthetic peptide located within the following region: FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 79 kDa
Gene Name poly(ADP-ribose) polymerase family member 12
Background The specific function of this protein remains unknown.
Synonyms ARTD12; MST109; MSTP109; ZC3H1; ZC3HDC1
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Horse: 93%; Rat: 86%; Mouse: 86%; Bovine: 85%; Rabbit: 83%; Dog: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.