MKLP1 (KIF23) Rabbit Polyclonal Antibody

CAT#: TA334709

Rabbit Polyclonal Anti-KIF23 Antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "MKLP1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KIF23 antibody: synthetic peptide directed towards the N terminal of human KIF23. Synthetic peptide located within the following region: MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 98 kDa
Gene Name kinesin family member 23
Background KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.
Synonyms CHO1; KNSL5; MKLP-1; MKLP1
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Rat: 85%; Horse: 85%; Mouse: 85%; Bovine: 85%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.