PI 3 Kinase regulatory subunit 4 (PIK3R4) Rabbit Polyclonal Antibody

CAT#: TA334554

Rabbit Polyclonal Anti-PIK3R4 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of phosphoinositide-3-kinase, regulatory subunit 4 (PIK3R4)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human phosphoinositide-3-kinase, regulatory subunit 4 (PIK3R4), 20 µg
    • 20 ug

USD 867.00

Other products for "PI 3 Kinase regulatory subunit 4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PIK3R4 antibody: synthetic peptide directed towards the N terminal of human PIK3R4. Synthetic peptide located within the following region: HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 153 kDa
Gene Name phosphoinositide-3-kinase regulatory subunit 4
Background The protein can regulate subunit of the PI3K complex. May regulate membrane trafficking late in the endocytic pathway.
Synonyms p150; VPS15
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Bovine: 86%
Reference Data
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Regulation of autophagy

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.