PPP1R1C Rabbit Polyclonal Antibody

CAT#: TA334115

Rabbit Polyclonal Anti-PPP1R1C Antibody

Product Images

Host: Rabbit; Target Name: PPP1R1C; Sample Tissue: U937 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PPP1R1C Antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1R1C. Synthetic peptide located within the following region: GELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 11 kDa
• Gene Name: protein phosphatase 1 regulatory inhibitor subunit 1C
• Database Link:
  NP_001074014
  Entrez Gene 151242 Human
  UniProt ID Q8WVI7
• Background: Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation.
• Synonyms: IPP5
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 85%

Reference Data

• Protein Families: Druggable Genome, Phosphatase