Upstream Binding Protein 1 (UBP1) Rabbit Polyclonal Antibody

CAT#: TA333869

Rabbit Polyclonal Anti-UBP1 Antibody

Product Images

WB Suggested Anti-UBP1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Daudi cell lysateUBP1 is supported by BioGPS gene expression data to be expressed in Daudi

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-UBP1 Antibody: synthetic peptide directed towards the middle region of human UBP1. Synthetic peptide located within the following region: GASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKED
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: upstream binding protein 1 (LBP-1a)
• Database Link:
  NP_055332
  Entrez Gene 7342 Human
  UniProt ID Q9NZI7
• Background: UBP1 is an important SF1-independent transcriptional activator stimulating P450scc expression in human placental JEG-3 cells, whereas LBP-9 modulates the action of UBP1, exerting both positive and negative effects
• Synonyms: LBP-1a; LBP-1B; LBP1A; LBP1B
• Note: Immunogen sequence homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Mouse: 86%; Rabbit: 86%

Reference Data

• Protein Families: Transcription Factors