KCC2 (SLC12A5) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of solute carrier family 12 (potassium-chloride transporter), member 5 (SLC12A5), transcript variant 2
USD 665.00
Purified recombinant protein of Human solute carrier family 12 (potassium/chloride transporter), member 5 (SLC12A5), transcript variant 2, with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20 µg
USD 867.00
Other products for "KCC2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Slc12a5 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TDCEDGDGGANPGDGNPKESSPFINSTDTEKGREYDGRNMALFEEEMDTS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 123 kDa |
Gene Name | solute carrier family 12 member 5 |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | EIEE34; EIG14; hKCC2; KCC2 |
Note | Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.