Amigo2 Rabbit Polyclonal Antibody

CAT#: TA333380

Rabbit Polyclonal Anti-Amigo2 Antibody

Product Images

WB Suggested Anti-Amigo2 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Amigo2 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FHALGFIHEAQVGERAIVHCDGKTGNGNTDFIWVGPDNRLLEPDKDTGNF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: adhesion molecule with Ig like domain 2
• Database Link:
  NP_877968
  Entrez Gene 300186 Rat
  UniProt ID Q7TNJ4
• Background: Amigo2 is required for depolarization-dependent survival of cultured cerebellar granule neurons. It may mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3. It also may contribute to signal transduction through its intracellular domain.
• Synonyms: ALI1; Alivin-1; AMIGO-2; DEGA
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Guinea pig: 93%; Rabbit: 85%