STEAP3 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human STEAP family member 3 (STEAP3), transcript variant 3, 20 µg
USD 867.00
Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 1
USD 665.00
Other products for "STEAP3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-STEAP3 Antibody: synthetic peptide directed towards the N terminal of human STEAP3. Synthetic peptide located within the following region: LVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 54 kDa |
Gene Name | STEAP3 metalloreductase |
Database Link | |
Background | AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT |
Synonyms | AHMIO2; dudlin-2; dudulin-2; pHyde; STMP3; TSAP6 |
Note | Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Rabbit: 93%; Pig: 92%; Bovine: 86%; Guinea pig: 86%; Dog: 79% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | p53 signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.