Speedy protein C (SPDYC) Rabbit Polyclonal Antibody

CAT#: TA332276

Rabbit Polyclonal Anti-SPDYC Antibody

Product Images

Host: Rabbit; Target Name: SPDYC; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SPDYC Antibody is: synthetic peptide directed towards the N-terminal region of Human SPDYC. Synthetic peptide located within the following region: PISISYEMSDSQDPTTSPVVTTQVELGGCSRQGGGNGFLRFRQHQEVQAF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: speedy/RINGO cell cycle regulator family member C
• Database Link:
  NP_001008778
  Entrez Gene 387778 Human
  UniProt ID Q5MJ68
• Background: SPDYC promotes progression through the cell cycle via binding and activation of CDK1 and CDK2. It is involved in the spindle-assembly checkpoint. It is required for recruitment of MAD2L1, BUBR1 and BUB1 to kinetochores and is required for the correct localization of the active form of Aurora B in prometaphase.
• Synonyms: Ringo2; RINGOC
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Pathways: Oocyte meiosis, Progesterone-mediated oocyte maturation