SEMA4A Rabbit Polyclonal Antibody

CAT#: TA331773

Rabbit Polyclonal Anti-SEMA4A Antibody

Product Images

WB Suggested Anti-SEMA4A Antibody Titration: 1.25ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SEMA4A Antibody: synthetic peptide directed towards the N terminal of human SEMA4A. Synthetic peptide located within the following region: PSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: semaphorin 4A
• Database Link:
  NP_071762
  Entrez Gene 64218 Human
  UniProt ID Q9H3S1
• Background: SEMA4A is a member of the semaphorin family of soluble and transmembrane proteins. Semaphorins are involved in guidance of axonal migration during neuronal development and in immune responses.
• Synonyms: CORD10; RP35; SEMAB; SEMB
• Note: Immunogen sequence homology: Human: 100%; Mouse: 100%; Rabbit: 93%; Pig: 91%; Dog: 86%; Rat: 86%; Horse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Axon guidance