C20orf112 (NOL4L) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of chromosome 20 open reading frame 112 (C20orf112)
USD 665.00
Purified recombinant protein of Homo sapiens chromosome 20 open reading frame 112 (C20orf112), 20 µg
USD 867.00
Other products for "C20orf112"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-C20orf112 antibody is: synthetic peptide directed towards the N-terminal region of Human C20orf112. Synthetic peptide located within the following region: LRVMNSQEQDETSVSSEDFDMSDSTWMSADPHLASSLSPSQDERMRSPQN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 74 kDa |
Gene Name | nucleolar protein 4-like |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | C20orf112; C20orf113; dJ1184F4.2; dJ1184F4.4 |
Note | Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Rabbit: 92% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.