HLA-DQA2 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2)
USD 436.00
Other products for "HLA-DQA2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the middle region of human HLA-DQA2. Synthetic peptide located within the following region: LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 28 kDa |
Gene Name | major histocompatibility complex, class II, DQ alpha 2 |
Database Link | |
Background | This gene belongs to the HLA class II alpha chain family. The encoded protein forms a heterodimer with a class II beta chain. It is located in intracellular vesicles and plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (B lymphocytes, dendritic cells, macrophages) and are used to present antigenic peptides on the cell surface to be recognized by CD4 T-cells. |
Synonyms | DX-ALPHA; HLA-DXA |
Note | Human: 100%; Pig: 93%; Goat: 86%; Horse: 86%; Mouse: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Allograft rejection, Antigen processing and presentation, Asthma, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Type I diabetes mellitus, Viral myocarditis |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.