ZCWPW1 Rabbit Polyclonal Antibody

CAT#: TA330663

Rabbit Polyclonal Anti-ZCWPW1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of zinc finger, CW type with PWWP domain 1 (ZCWPW1)
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "ZCWPW1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZCWPW1 antibody is: synthetic peptide directed towards the N-terminal region of Human ZCWPW1. Synthetic peptide located within the following region: KATMKNVPSREQEKKRKAQINKQAEKKEKEKSSLTNAEFEEIVQIVLQKS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 71 kDa
Gene Name zinc finger CW-type and PWWP domain containing 1
Background The function of this protein remains unknown.
Synonyms ZCW1
Note Human: 100%; Pig: 92%; Dog: 85%; Horse: 85%; Rabbit: 85%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.