SOX9 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human SRY (sex determining region Y)-box 9 (SOX9), 20 µg
USD 867.00
Other products for "SOX9"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human, Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the N terminal of human SOX9. Synthetic peptide located within the following region: PCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 56 kDa |
Gene Name | SRY-box 9 |
Database Link | |
Background | SOX9 recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. |
Synonyms | CMD1; CMPD1; SRA1; SRXX2; SRXY10 |
Note | Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Goat: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
Reference Data | |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.