Semaphorin 3D (SEMA3D) Rabbit Polyclonal Antibody

CAT#: TA329786

Rabbit polyclonal Anti-SEMA3D Antibody

Product Images

WB Suggested Anti-SEMA3D Antibody Titration: 0.2-1 ug/ml; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEMA3D antibody: synthetic peptide directed towards the middle region of human SEMA3D. Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: semaphorin 3D
• Database Link:
  NP_689967
  Entrez Gene 223117 Human
  UniProt ID O95025
• Background: SEMA3D induces the collapse and paralysis of neuronal growth cones. SEMA3D could potentially act as repulsive cues toward specific neuronal populations.
• Synonyms: coll-2; Sema-Z2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Axon guidance