Runx2 Rabbit Polyclonal Antibody

CAT#: TA329204

Rabbit Polyclonal anti-Runx2 antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Runx2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Runx2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 57 kDa
Gene Name runt-related transcription factor 2
Background The function of Runx2 remains unknown.
Synonyms AML3; CBF-alpha-1; CBFA1; CCD; CCD1; MGC120022; MGC120023; OSF-2; OSF2; PEA2aA; PEBP2A; PEBP2A1; PEBP2A2; PEBP2aA; PEBP2aA1
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.