Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Human Protease-activated Receptor-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KNESGLTEYRLVSINK, corresponding to amino acid residues 61-76 of human PAR-1. Extracellular, N terminal. |
Rabbit polyclonal Thrombin Receptor antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Thrombin Receptor. |
Rabbit polyclonal F2R / PAR1 (Cleaved-Ser42) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PAR1. |
Thrombin Receptor (F2R) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-F2R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2R antibody: synthetic peptide directed towards the N terminal of human F2R. |
Rabbit Polyclonal Anti-F2R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2R antibody: synthetic peptide directed towards the C terminal of human F2R. Synthetic peptide located within the following region: YAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSA |
Rabbit Polyclonal Anti-Thrombin Receptor Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Thrombin Receptor Antibody: A synthesized peptide derived from human Thrombin Receptor |
Rabbit Polyclonal Thrombin Receptor Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. In vivo generated recombinant protein fragment. |
Active filters
Target Symbol
- THROMBIN RECEPTOR