Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
Rabbit Polyclonal ETO Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETO antibody: human ETO (runt-related transcription factor 1; translocated to, 1 (cyclin D-related)) using two KLH-conjugated synthetic peptides containing sequences from the N-terminal and the central region of the protein, respect |
RUNX1T1 (ETO) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-RUNX1T1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RUNX1T1 antibody: synthetic peptide directed towards the middle region of human RUNX1T1. Synthetic peptide located within the following region: LHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAI |
Rabbit Polyclonal AML-ETO Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AML-ETO antibody: the AML-ETO (RUNX1) fusion protein, using 3 different KLH-conjugated synthetic peptides. The antibody recognizes the ETO (RUNX1T1) part of the fusion protein. |
Rabbit Polyclonal RUNX1T1/ETO Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Anti-RUNX1T1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RUNX1T1 antibody: synthetic peptide directed towards the middle region of human RUNX1T1. Synthetic peptide located within the following region: RQCNLQQFIQQTGAALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHA |
Runx1t1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RUNX1T1