Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-EBF3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EBF3 antibody: synthetic peptide directed towards the middle region of human EBF3. Synthetic peptide located within the following region: AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ |
Ebf3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
EBF3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EBF3 (NP_001005463.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- EBF3