EBF3 Rabbit Polyclonal Antibody

CAT#: TA329414

Rabbit Polyclonal anti-EBF3 antibody

Product Images

WB Suggested Anti-EBF3 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:62500; Positive Control: Raji cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EBF3 antibody: synthetic peptide directed towards the middle region of human EBF3. Synthetic peptide located within the following region: AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: early B-cell factor 3
• Database Link:
  NP_001005463
  Entrez Gene 253738 Human
  UniProt ID Q9H4W6
• Background: EB1 family proteins are evolutionarily conserved proteins that bind microtubule plus-ends and centrosomes and regulate the dynamics and organization of microtubules. Human EB1 family proteins, which include EB1, EBF3, and RP1, also associate with the tumor suppressor protein adenomatous polyposis coli (APC) and p150glued, a component of the dynactin complex.
• Synonyms: COE3; E-2; EBF-3; O; OE-2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors