Rabbit Polyclonal Anti-CAPRIN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CAPRIN2 Antibody is: synthetic peptide directed towards the N-terminal region of Human CAPRIN2. Synthetic peptide located within the following region: FGYQSPSGHSEEEREGNMKSAKPQVNHSQHGESQRALSPLQSTLSSAASP |
Rabbit Polyclonal Anti-CAPRIN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CAPRIN2 Antibody is: synthetic peptide directed towards the C-terminal region of Human CAPRIN2. Synthetic peptide located within the following region: YKRGGTSGGPRANSRAGWSDSSQVSSPERDNETFNSGDSGQGDSRSMTPV |
CAPRIN2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CAPRIN2 |
CAPRIN2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CAPRIN2. |
Germany
Japan
United Kingdom
China