CAPRIN2 Rabbit Polyclonal Antibody

CAT#: TA334154

Rabbit Polyclonal Anti-CAPRIN2 Antibody

Product Images

WB Suggested Anti-CAPRIN2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CAPRIN2 Antibody is: synthetic peptide directed towards the C-terminal region of Human CAPRIN2. Synthetic peptide located within the following region: YKRGGTSGGPRANSRAGWSDSSQVSSPERDNETFNSGDSGQGDSRSMTPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 124 kDa
• Gene Name: caprin family member 2
• Database Link:
  NP_001002259
  Entrez Gene 65981 Human
  UniProt ID Q6IMN6
• Background: The protein encoded by this gene may be involved in the transitioning of erythroblasts from a highly proliferative state to a terminal phase of differentiation. High level expression of the encoded protein can lead to apoptosis. Several transcript variants encoding different isoforms have been found for this gene.
• Synonyms: C1QDC1; EEG-1; EEG1; RNG140
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%