Vav3 (NM_146139) Mouse Recombinant Protein
CAT#: TP526734
Purified recombinant protein of Mouse vav 3 oncogene (Vav3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Vav3"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR226734 representing NM_146139
Red=Cloning site Green=Tags(s) MPIFTFVSEQGPFKPPEKRTNGLRRASRQVDPGLPKMQVIRNYTGTPAPGLHEGPPLHIQAGDTVELLRG DAHSVFWQGRNLASGEVGFFPSDAVKPSPCVPKPVDYSCQPWYAGPMERLQAETELINRVNSTYLVRHRT KESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPE QPAGQRGNRTGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDMVKIYTKMSANGWWRGEVNGRVGWFPS TYVEEDE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 33.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_666251 |
Locus ID | 57257 |
UniProt ID | Q9R0C8 |
Cytogenetics | 3 F3 |
Refseq Size | 3061 |
Refseq ORF | 861 |
Synonyms | A530094I06Rik; AA986410; Idd18.1 |
Summary | Exchange factor for GTP-binding proteins RhoA, RhoG and, to a lesser extent, Rac1. Binds physically to the nucleotide-free states of those GTPases (By similarity). Plays an important role in angiogenesis. Its recruitment by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. May be important for integrin-mediated signaling, at least in some cell types. In osteoclasts, along with SYK tyrosine kinase, required for signaling through integrin alpha-v/beta-1 (ITAGV-ITGB1), a crucial event for osteoclast proper cytoskeleton organization and function. This signaling pathway involves RAC1, but not RHO, activation. Necessary for proper wound healing. In the course of wound healing, required for the phagocytotic cup formation preceding macrophage phagocytosis of apoptotic neutrophils. Responsible for integrin beta-2-mediated macrophage adhesion and, to a lesser extent, contributes to beta-3-mediated adhesion. Does not affect integrin beta-1-mediated adhesion.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.