Gabpb2 (NM_172512) Mouse Recombinant Protein

CAT#: TP521912

Purified recombinant protein of Mouse GA repeat binding protein, beta 2 (Gabpb2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR221912 representing NM_172512
  Red=Cloning site Green=Tags(s)
  
  MSLVDLGKRLLEAARKGQDDEVRTLMANGAPFTTDWLGTSPLHLAAQYGHYSTAEVLLRAGVSRDARTKV
  DRTPLHMAAADGHVHIVELLVRSGADVNAKDMLQMTALHWATEHHHRDVVELLIKYGADVYAFSKFDKSA
  FDIAMEKNNTEILVMLQEAMQNQVNTNHERANPVANPVTVTAPFIFTSGEVINLASFVSSANTKATSAHL
  EEMEEGNSLDSSTQQVVGSGGQRVITIVTDGVPLGNIQTSLPAGGIGQPFIVTMQDGQQVLTVPAGQVAE
  ETIIEDEEEEEEKLPLVKRPRMAEMTNRVEEMKEGSERELLQQQLQEANRRAQEYRHQLLKKEQEAEQYR
  LRLEAMAQQQTNGVEVDVTVVEEVAEVDAVVVTEGDEVERATQVMKSGRTTEPHTNVSIETISS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 46.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_766100
• Locus ID: 213054
• UniProt ID: P81069
• Cytogenetics: 3 40.74 cM
• Refseq Size: 8606
• Refseq ORF: 1242
• Synonyms: 1810015F01Rik; 5830427M07; 9430006E19Rik; A430024B14Rik; AV050852; Gabpb2-1
• Summary: Transcription factor capable of interacting with purine rich repeats (GA repeats). Must associate with GABP-alpha to bind DNA.[UniProtKB/Swiss-Prot Function]