Aldh4a1 (NM_175438) Mouse Recombinant Protein

CAT#: TP508902

Purified recombinant protein of Mouse aldehyde dehydrogenase 4 family, member A1 (Aldh4a1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208902 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPLPSLRRSLLSHAWRSAGLRWKHTSSLKVANEPILAFSQGSPERDALQKALKDLKGQTEAIPCVVGDE
  EVWTSDIQYQLSPFNHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSGPRRA
  EVLAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAVELEGEQPISVPPSTNHTVYRGLEGFVAAISPFN
  FTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCG
  INFTGSVPTFKHLWRQVAQNLDRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSAC
  SRLYVPKSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQC
  NESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFAQDKAIVQ
  EATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSY
  MQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 61.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_780647
• Locus ID: 212647
• UniProt ID: Q8CHT0
• Cytogenetics: 4 70.79 cM
• Refseq Size: 3355
• Refseq ORF: 1689
• Synonyms: A930035F14Rik; Ahd-1; Ahd1; Aldh4; Aldh5a1; E330022C09; P5cd; P5cdh; P5cdhl; P5cdhs; Ssdh1
• Summary: Irreversible conversion of delta-1-pyrroline-5-carboxylate (P5C), derived either from proline or ornithine, to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes (By similarity).[UniProtKB/Swiss-Prot Function]