Plat (NM_008872) Mouse Recombinant Protein
CAT#: TP508868
Purified recombinant protein of Mouse plasminogen activator, tissue (Plat), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Plat"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR208868 protein sequence
Red=Cloning site Green=Tags(s) MKRELLCVLLLCGLAFPLPDQGIHGRFRRGARSYRATCRDEPTQTTYQQHQSWLRPMLRSSRVEYCRCNS GLVQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPDGFVGKRCDIDTRATCFEEQGITYRGTWSTAE SGAECINWNSSVLSLKPYNARRPNAIKLGLGNHNYCRNPDRDLKPWCYVFKAGKYTTEFCSTPACPKGKS EDCYVGKGVTYRGTHSLTTSQASCLPWNSIVLMGKSYTAWRTNSQALGLGRHNYCRNPDGDARPWCHVMK DRKLTWEYCDMSPCSTCGLRQYKRPQFRIKGGLYTDITSHPWQAPIFVKNKRSPGERFLCGGVLISSCWV LSAAHCFLERFPPNHLKVVLGRTYRVVPGEEEQTFEIEKYIVHEEFDDDTYDNDIALLQLRSQSKQCAQE SSSVGTACLPDPNLQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQHLFNKTVTNNMLC AGDTRSGGNQDLHDACQGDSGGPLVCMINKQMTLTGIISWGLGCGQKDVPGVYTKVTNYLDWIHDNMKQ myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 63.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_032898 |
Locus ID | 18791 |
UniProt ID | P11214 |
Cytogenetics | 8 11.42 cM |
Refseq Size | 2548 |
Refseq ORF | 1680 |
Synonyms | AU020998; AW212668; D8Ertd2; D8Ertd2e; t; t-; tPA |
Summary | This gene encodes a key enzyme of the fibrinolytic pathway. The encoded protein undergoes proteolytic processing by plasmin to generate a heterodimeric serine protease that cleaves the proenzyme plasminogen to produce plasmin, a protease that is required to break down fibrin clots. Additionally, the encoded protein is involved in other biological processes such as synaptic plasticity, cell migration and tissue remodeling. Mice lacking the encoded protein display a reduction in long-term potentiation in hippocampus and conversely, transgenic mice overexpressing the encoded protein have increased and prolonged long-term potentiation. [provided by RefSeq, Jul 2015] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.