Frs2 (NM_177798) Mouse Recombinant Protein

CAT#: TP508163

Purified recombinant protein of Mouse fibroblast growth factor receptor substrate 2 (Frs2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208163 representing NM_177798
  Red=Cloning site Green=Tags(s)
  
  MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGVMELTDTELILYTRKRDSVKWHYLCLRRYGYDSN
  LFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERSSHQTELEVPRTPRTPTTPG
  LGAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGEESTHPLLVAEEQVHTYVNTTGVQEERKNRA
  SVHVPPEARVSNAESNTPKEEPSNPEDRDPQVLLKPEGVRFVLGPTPVQKQLMEKEKLEQLGKDPVSGSG
  AGNTEWDTGYDSDERRDVPPVNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRPALLNYE
  NLPSLPPVWEARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIDYSKRRDCTPTVF
  NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTAAMSNLQKALP
  RDDGTSRKTRHNSTDLPM
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 57.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_808466
• Locus ID: 327826
• UniProt ID: Q8C180
• Cytogenetics: 10 D2
• Refseq Size: 5701
• Refseq ORF: 1524
• Synonyms: 4732458E18; C330018A15Rik; Frs2alpha; SNT1
• Summary: Adapter protein that links activated FGR and NGF receptors to downstream signaling pathways. Plays an important role in the activation of MAP kinases and in the phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, in response to ligand-mediated activation of FGFR1. Modulates signaling via SHC1 by competing for a common binding site on NTRK1.[UniProtKB/Swiss-Prot Function]