Sox10 (BC018551) Mouse Recombinant Protein

CAT#: TP507447

Purified recombinant protein of Mouse SRY-box containing gene 10 (cDNA clone MGC:18351 IMAGE:3675437), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR207447 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEEQDLSEVELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQDGEADDDKFPV
  CIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGK
  LWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGAAAIQAHYKSA
  HLDHRHPEEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKRDGRSLGEGGKPHIDFGNVDIGE
  ISHEVMSNMETFDVTELDQYLPPNGHPGHVGSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGV
  DAKAQVKTETTGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHAGQASG
  LYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 49.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 20665
• UniProt ID: Q04888
• Cytogenetics: 15 37.7 cM
• Refseq Size: 2554
• Refseq ORF: 1398
• Synonyms: Dom; gt; Sox21
• Summary: Transcription factor that plays a central role in developing and mature glia (PubMed:24204311, PubMed:27532821). Specifically activates expression of myelin genes, during oligodendrocyte (OL) maturation, such as DUSP15 and MYRF, thereby playing a central role in oligodendrocyte maturation and CNS myelination (PubMed:24204311, PubMed:27532821). Once induced, MYRF cooperates with SOX10 to implement the myelination program (PubMed:24204311). Transcriptional activator of MITF, acting synergistically with PAX3 (By similarity).[UniProtKB/Swiss-Prot Function]