Kyat1 (NM_172404) Mouse Recombinant Protein

CAT#: TP506747

Purified recombinant protein of Mouse kynurenine aminotransferase 1 (Kyat1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206747 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSKQLQARRLEGIDHNPWVEFTRLSKEYDVVNLGQGFPDFSPPDFAVQAFQQATTGNFMLNQYTSAFGYP
  PLTKILASFFGKLLGQEMDPLKNVLVTVGAYGALFTAFQALVDEGDEVIIIEPAFNCYEPMTMMAGGRPV
  FVSLRLSPAPKGQLGSSNDWQLDPTELASKFTPRTKILVLNTPNNPLGKVFSKKELELVAALCQQHDVLC
  FSDEVYQWLVYDGHQHISIASLPGMWERTLTIGSAGKSFSATGWKVGWVMGPDNIMKHLRTVHQNSIFHC
  PTQAQAAVAQCFEREQQHFGQPSSYFLQLPQAMGLNRDHMIQSLQSVGLKPLIPQGSYFLIADISDFKSS
  MPDLPGAMDEPYDTRFAKWMIKNKGLSAIPVSTFYSQPHHKDFDHYIRFCFVKDKATLQAMDKRLCSWKG
  EPQA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 47.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_765992
• Locus ID: 70266
• UniProt ID: Q8BTY1, Q05CI8
• Cytogenetics: 2 B
• Refseq Size: 1944
• Refseq ORF: 1275
• Synonyms: 2010009K05Rik; AI182306; Ccbl1; Gtk; Kat1; KatI
• Summary: Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Metabolizes the cysteine conjugates of certain halogenated alkenes and alkanes to form reactive metabolites. Catalyzes the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond (By similarity).[UniProtKB/Swiss-Prot Function]